PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_135530_srzn.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 408aa    MW: 44914.9 Da    PI: 6.4666
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_135530_srzn.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF87.67.1e-28958150
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                        krien++nrqvtfskRrng++KKA+ELS+LCd+++a+i+fs++g+l  +s
  Bv6_135530_srzn.t1  9 KRIENNTNRQVTFSKRRNGLIKKAYELSILCDIDIALIMFSPSGRLSHFS 58
                        79********************************************9997 PP

2K-box27.11.7e-101111791078
               K-box  10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqie 78 
                         ++++ e lqqe+++L+ ++++ + ++R +  + +   s+ eL++ e++L ++l+++ ++K+ ll ++++
  Bv6_135530_srzn.t1 111 SNSNLEDLQQEVNNLQHQLQMAEDQLRIYEPDPMAFTSVGELESCEKNLMDALSHVSQRKKYLLSNHMS 179
                         67899***********************************************************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.857161IPR002100Transcription factor, MADS-box
SMARTSM004328.5E-38160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.83E-30287IPR002100Transcription factor, MADS-box
CDDcd002654.44E-37275No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-26323IPR002100Transcription factor, MADS-box
PfamPF003198.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004046.5E-263859IPR002100Transcription factor, MADS-box
PfamPF014863.5E-6114180IPR002487Transcription factor, K-box
PROSITE profilePS512976.787115206IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010152Biological Processpollen maturation
GO:0080092Biological Processregulation of pollen tube growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 408 aa     Download sequence    Send to blast
MGRVKLQIKR IENNTNRQVT FSKRRNGLIK KAYELSILCD IDIALIMFSP SGRLSHFSGK  60
KRIEDVLTRY INLPDHDRGN FVHNREYLLG TLKKLKTEND IALQLANPAG SNSNLEDLQQ  120
EVNNLQHQLQ MAEDQLRIYE PDPMAFTSVG ELESCEKNLM DALSHVSQRK KYLLSNHMSS  180
YDPSGVQIFL DTSEGMPTSF EDMGWLPENG QNQGQIFTSS DPSNTITMRP NHPSATPVTT  240
TLYETLTHGQ GGNALNVAMD HKNNQMGSAT AAHHQQQHQQ QHQQPHQQQH QQHHPHDQTS  300
GAMGLSSWHQ TYTSNELLNV LMQSNNNSFS SLIKHELGEG PGGVGGATSA MVRGQAEVIP  360
ATTGCGGVGV GVGVVGGLVQ CSENVATADH STTSASNFDN EISQLNMQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P7e-18180181Myocyte-specific enhancer factor 2B
1tqe_Q7e-18180181Myocyte-specific enhancer factor 2B
1tqe_R7e-18180181Myocyte-specific enhancer factor 2B
1tqe_S7e-18180181Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680585.10.0PREDICTED: MADS-box transcription factor 27-like
SwissprotQ9LM464e-92AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLA0A0J8C9880.0A0A0J8C988_BETVU; Uncharacterized protein
STRINGVIT_07s0031g01140.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-92AGAMOUS-like 104